PNC-27 Peptide Peptides 27

PNC-27 Peptide

$144.99

10 People recently viewed this product and 3 people have it in their cart!
Get it shipped by Friday, Jul 26 , Order in next

80 in stock (can be backordered)

Quantity discounts
1 $144.99
2-9 $141.99
10-19 $138.99
20+ $135.99

3rd Party Tested
All of our products and batches are analyzed and tested by independent 3rd party laboratories for purity and quality assurance.

Delivery Guarantee
We guarantee the safe arrival of your package. If for any reason your package doesn’t arrive, please contact us and we will work with you to ensure you get your products in a timely fashion.

Lyophilized Powder
Lyophilization is defined as a freeze-drying process that removes water from a product after it is frozen and placed under a vacuum.

USA > $150
U.S. orders over $150 ship free, usually within one to two business days.

Discreet Shipping
All items are discreetly shipped in order to protect the privacy of our customers.

PNC-27 is a synthetically created peptide designed to specifically target and destroy cancer cells. It is a member of the PNC set of investigational proteins designed to attach to malformed (cancerous) cells and cause them to die through cell necrosis, all while leaving normal, healthy cells intact and unharmed.

The PNC-27 peptide contains an HDM-2 binding domain corresponding to residues 12-26 of p53 and a transmembrane-penetrating domain. This has been found to enable the peptide to bind to and kill cancer cells through membranolysis, or disruption of the cell membrane.

Through research and study on animal subjects, the PNC-27 peptide has been shown to be highly effective in selectively targeting a wide variety of specific forms of cancer, including pancreatic cancer, breast cancer, leukemia, melanoma, and additional cancer lines.

CAS Number
1159861-00-3
Appearance Lyophilized Powder
Synonyms PNC-27
Molecular Formula C188H293N53O44S
Sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Molecular Weight 4031.7 g/mol

Important Information About This Research Product:

  1. Your vials are not empty. The product is at the bottom of the vial.
  2. All peptides come in a lyophilized (freeze-dried) powder, that must be reconstituted with bacteriostatic water (this is not something that we carry).
  3. Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
  4. All products purchased are for laboratory & research use ONLY, this means we cannot provide any further instructions on reconstitution and/or dosing.

Get 10% Off Your First Order!

Sign up today to stay up-to-date with new products and special promotions when you join our newsletter!

1 review for PNC-27 Peptide

5.0 Rating
1-1 of 1 review
  1. Thanks for extra attention with fast shipping. You’re the best peptide company ever!!!

Add a review
You must be logged in to post a review Log In
  • 10% offSale
    Oxytocin Peptide

    Oxytocin Peptide

    $19.99 - $29.99 $29.99 Add to cart
  • 10% offSale
    GHRP-2 (10mg x 10 vials) & Sermorelin (5mg x 10 vials)Sale!

    GHRP-2 (10mg x 10 vials) & Sermorelin (5mg x 10 vials)

    Rated 0 out of 5
    Original price was: $872.00.Current price is: $784.80. Add to cart
  • 10% offSale
    CJC-1295 w/ DAC (5mg x 10 vials) & Ipamorelin (10mg x 10 vials)Sale!

    CJC-1295 w/ DAC (5mg x 10 vials) & Ipamorelin (10mg x 10 vials)

    Rated 0 out of 5
    Original price was: $1,240.00.Current price is: $1,116.00. Add to cart
  • 10% offSale
    PT-141 PeptideOut of Stock

    PT-141 Peptide

    $23.99 - $32.99 $32.99 Available for backorder